Compare

Side by side. No hype.

Compare up to four records. Compounds, Watchlist entries and combinations retain their separate research and inventory status. We never pick a winner.

RowNAD+TB-500 (Thymosin β4)
IdentityNAD+ · sequence pending · MW —TB-500 (Thymosin β4) · 43 aa · MW 4921.46
Record typeCompoundCompound
AliasesNicotinamide adenine dinucleotide · NADThymosin beta-4 · Tβ4 · TMSB4X · Thymosin β4 (synthetic fragment)
ComponentsNot a combinationNot a combination
Mapped receptors / targetsNo target mapped hereNo target mapped here
Research statusCore research libraryCore research library
CommerceInformational profileInformational profile
TopicAging & Cell EnergyRecovery & Repair
Kinds of studies checkedNo qualifying record is currently indexed in OnimaChain's corpusCells in a dish (in vitro) 2 · Mice 1 · Rats 1 · Separate research teams Bayrak BY · Cha HJ · Lim DS · Lachowicz JI · Gesteira TF · How it works 1
How far it has been testedNo outcome mappedcell-migration: Cells in a dish
Studies in peopleNone indexed to this exact recordNone indexed to this exact record
Real-world reportsReal-world reports checked: 0 · Time window: none · Platforms connected: noneReal-world reports checked: 0 · Time window: none · Platforms connected: none
How trustworthy is the chatterNot measured yet — no reports collectedNot measured yet — no reports collected
Separate research teamsNot checked yet5 senior author(s) across 5 studies
What the studies looked atNo topics yetCell migration · How cells move (actin) · Wound-healing research
Claims trackedNone indexed to this exact recordCLAIM-TB4-CELL-MIGRATION
Legal statusNo regulator decision listed for this exact recordNo regulator decision listed for this exact record
Where the 3D shape comes fromNot a peptideSequence-derived illustration (not a measured structure)
Last updateNo claim change recorded2026-09-20 — Claim record created — CLAIM-TB4-CELL-MIGRATION

Residue diff — NAD+ vs TB-500 (Thymosin β4)

Residue diff requires two verified, listed single-compound sequences. A stack has no single sequence.

NAD+

Sequence pending verification

TB-500 (Thymosin β4)

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES