Compare
Side by side. No hype.
Compare up to four records. Compounds, Watchlist entries and combinations retain their separate research and inventory status. We never pick a winner.
| Row | TB-500 (Thymosin β4) | BPC-157 |
|---|---|---|
| Identity | TB-500 (Thymosin β4) · 43 aa · MW 4921.46 | BPC-157 · 15 aa · MW 1419.55 |
| Record type | Compound | Compound |
| Aliases | Thymosin beta-4 · Tβ4 · TMSB4X · Thymosin β4 (synthetic fragment) | Body Protection Compound 157 · Pentadecapeptide BPC 157 · PL 14736 · Bepecin |
| Components | Not a combination | Not a combination |
| Mapped receptors / targets | No target mapped here | No target mapped here |
| Research status | Core research library | Core research library |
| Commerce | Informational profile | Informational profile |
| Topic | Recovery & Repair | Recovery & Repair |
| Kinds of studies checked | Cells in a dish (in vitro) 2 · Mice 1 · Rats 1 · Separate research teams Bayrak BY · Cha HJ · Lim DS · Lachowicz JI · Gesteira TF · How it works 1 | Cells in a dish (in vitro) 1 · Rats 1 · Separate research teams Pang JH · Bayrak BY · Staresinic M · Cushman DM · Apostolakos JM · How it works 1 |
| How far it has been tested | cell-migration: Cells in a dish | tendon: Cells in a dish → Rat |
| Studies in people | None indexed to this exact record | None indexed to this exact record |
| Real-world reports | Real-world reports checked: 0 · Time window: none · Platforms connected: none | Real-world reports checked: 0 · Time window: none · Platforms connected: none |
| How trustworthy is the chatter | Not measured yet — no reports collected | Not measured yet — no reports collected |
| Separate research teams | 5 senior author(s) across 5 studies | 5 senior author(s) across 5 studies |
| What the studies looked at | Cell migration · How cells move (actin) · Wound-healing research | Tendon research · Ligament research · Gastrointestinal research · Blood-vessel signaling |
| Claims tracked | CLAIM-TB4-CELL-MIGRATION | CLAIM-BPC157-TENDON-REPAIR |
| Legal status | No regulator decision listed for this exact record | No regulator decision listed for this exact record |
| Where the 3D shape comes from | Sequence-derived illustration (not a measured structure) | Sequence-derived illustration (not a measured structure) |
| Last update | 2026-09-20 — Claim record created — CLAIM-TB4-CELL-MIGRATION | 2026-09-20 — Claim record created — CLAIM-BPC157-TENDON-REPAIR |
Residue diff — TB-500 (Thymosin β4) vs BPC-157
Longest shared subsequence: KP (2 residues, positions 3 / 7)
TB-500 (Thymosin β4)
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
BPC-157
GEPPPGKPADDAGLV