Compare
Side by side. No hype.
Compare up to four records. Compounds, Watchlist entries and combinations retain their separate research and inventory status. We never pick a winner.
| Row | Tesamorelin | TB-500 (Thymosin β4) |
|---|---|---|
| Identity | Tesamorelin · sequence pending · MW — | TB-500 (Thymosin β4) · 43 aa · MW 4921.46 |
| Record type | Compound | Compound |
| Aliases | Egrifta · TH9507 | Thymosin beta-4 · Tβ4 · TMSB4X · Thymosin β4 (synthetic fragment) |
| Components | Not a combination | Not a combination |
| Mapped receptors / targets | GHRH receptor | No target mapped here |
| Research status | Core research library | Core research library |
| Commerce | Informational profile | Informational profile |
| Topic | Growth & Muscle | Recovery & Repair |
| Kinds of studies checked | No qualifying record is currently indexed in OnimaChain's corpus | Cells in a dish (in vitro) 2 · Mice 1 · Rats 1 · Separate research teams Bayrak BY · Cha HJ · Lim DS · Lachowicz JI · Gesteira TF · How it works 1 |
| How far it has been tested | No outcome mapped | cell-migration: Cells in a dish |
| Studies in people | None indexed to this exact record | None indexed to this exact record |
| Real-world reports | Real-world reports checked: 0 · Time window: none · Platforms connected: none | Real-world reports checked: 0 · Time window: none · Platforms connected: none |
| How trustworthy is the chatter | Not measured yet — no reports collected | Not measured yet — no reports collected |
| Separate research teams | Not checked yet | 5 senior author(s) across 5 studies |
| What the studies looked at | No topics yet | Cell migration · How cells move (actin) · Wound-healing research |
| Claims tracked | None indexed to this exact record | CLAIM-TB4-CELL-MIGRATION |
| Legal status | No regulator decision listed for this exact record | No regulator decision listed for this exact record |
| Where the 3D shape comes from | Structure not verified | Sequence-derived illustration (not a measured structure) |
| Last update | No claim change recorded | 2026-09-20 — Claim record created — CLAIM-TB4-CELL-MIGRATION |
Residue diff — Tesamorelin vs TB-500 (Thymosin β4)
Residue diff requires two verified, listed single-compound sequences. A stack has no single sequence.
Tesamorelin
Sequence pending verification
TB-500 (Thymosin β4)
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
