Weight & Metabolism · commonly explored around metabolism and appetite

Semaglutide

Semaglutide is the GLP-1 medicine behind Wegovy and Ozempic. It turns down appetite and steadies blood sugar, with about 15% average weight loss in its main weight trial.

Informational profile

No verified OnimaChain inventory for this profile.

Also known as Ozempic · Wegovy · Rybelsus · NN9535

Mapped targets

Sequence
HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Length
31 residues
MW
Product tags
glp 1r · incretin analogue · lipidated
Checked sources
No checked source added yet
Structure provenance
Rendered from deposited C-alpha coordinates · RCSB PDB 7KI0 chain P; any unresolved tail is modeled

31 residues with Aib at residue 2 and a C18 fatty-diacid tether on Lys20 (GLP-1 positions 8 and 26). Deposited receptor-bound structures resolve the helical core.

See the simple guide ↓
GRGLFIVWAREAAEKGSSSLQGTYTDVHEFX
Rendered from deposited C-alpha coordinates · RCSB PDB 7KI0 chain P; any unresolved tail is modeled

Meet Semaglutide

The short version, before the deep dive.

Semaglutide is the GLP-1 medicine behind Wegovy and Ozempic. It turns down appetite and steadies blood sugar, with about 15% average weight loss in its main weight trial.

PulseChain

What’s new with Semaglutide

Section B

The quick read

Section C

Research at a glance

A simple picture of the sources we have checked. More color means more records in that category—not that the product works better.

We haven’t added a checked source for this yet.

This picture fills in as we add checked studies for this product.

Section D

What the sources looked at

These topics come only from sources in our record. We do not add a topic just because it is popular online.

No topics yet

Topics show up here once we have checked studies for this product and sorted them.

Section E

Why people look it up

A plain-language starting point. This is not a promise that the product will cause a result.

metabolism and appetite

See Semaglutide beside similar names.

The Portal of Tides lets you switch between a constellation, connection view, checked-source timeline, and topic map. It uses the products already in our collection—no fake customer counts.

Open Portal of Tides

Section F

What the record can tell us

A product page can show what was studied. It cannot promise what will happen to a person.

What we can show

No source topic has been added yet.

What we cannot promise

A lab result, animal study, online story, or product page cannot tell you what will happen to you. That question needs qualified medical guidance.

The short versionresearch is not a guaranteeWe keep the product, source, and claim separate so you can see which is which.

Section G

Claims people make

The big claims tied to this product. Open one to see where it came from and how it spread.

No claims tracked for this product yet

We only add a claim once we can point to where it started, or say clearly that we could not find out.

Section H

How far it has been tested

From cells in a dish, to mice, rats, bigger animals, people, proper trials, and finally regulator approval. The light stops where the checked studies stop.

We have not mapped how far any result has been tested yet.

Section I

How many separate teams

Ten papers from one lab are not ten separate confirmations.

Not checked yet

We only count teams from studies we have confirmed.

Section J

What doesn’t fit?

If a study disagrees, it goes here. We do not hide it.

No study we have checked pushes back yet

Studies that found nothing, disagree, or criticize the method will show up here once we add them. A study that only partly agrees is not the same as one that disagrees.

Section K

Timeline

What happened and when. Studies in one lane, real-world reports in another.

Research

0 events

No dated research update is indexed for this selection.

Trials

0 events

No trial milestones are indexed to this exact record yet.

Regulatory

0 events

No regulator decisions listed yet.

Real-world reports

0 events

No real-world reports yet — social platforms are not connected.

Section L

Sources

Every study we used. Only studies we confirmed on PubMed are shown as sources. Where a drug is FDA-approved, its official label sits beside them — that is an approval, not a sales pitch.

FDA application

Ozempic (semaglutide) — Drugs@FDA application overview

NDA 209637 · retrieved 2026-09-21

FDA-approved (2017) as Ozempic for type 2 diabetes. The current DailyMed label lists it as a GLP-1 receptor agonist used with diet and exercise to improve glycemic control in adults with type 2 diabetes mellitus.

Approved uses are brand- and indication-specific. Research-use vials on this site are not those prescription products.

Open source ↗

DailyMed index

Ozempic (semaglutide) — DailyMed label index

DailyMed query OZEMPIC · retrieved 2026-09-21

OZEMPIC (semaglutide) injection, for subcutaneous use. Initial U.S. approval: 2017. Boxed warning for rodent thyroid C-cell tumors; human relevance unknown.

Open source ↗

FDA application

Wegovy (semaglutide) — Drugs@FDA application overview

NDA 215256 · retrieved 2026-09-21

FDA-approved (2021) as Wegovy, a separate semaglutide brand for chronic weight management in eligible patients — not interchangeable with research-use material.

Open source ↗

We have not added PubMed studies for this product yet. The official labels above are the sources for now.

The building blocks, one by one

#CodeResidueClassChiralityFeatures
1HHistidinepositiveL
2Aibα-Aminoisobutyric acidhydrophobicLAib
3EGlutamatenegativeL
4GGlycinespecialLflexible
5TThreoninepolarL
6FPhenylalaninehydrophobicL
7TThreoninepolarL
8SSerinepolarL
9DAspartatenegativeL
10VValinehydrophobicL
11SSerinepolarL
12SSerinepolarL
13YTyrosinepolarL
14LLeucinehydrophobicL
15EGlutamatenegativeL
16GGlycinespecialLflexible
17QGlutaminepolarL
18AAlaninehydrophobicL
19AAlaninehydrophobicL
20KLysinepositiveLAcyl tether
21EGlutamatenegativeL
22FPhenylalaninehydrophobicL
23IIsoleucinehydrophobicL
24AAlaninehydrophobicL
25WTryptophanhydrophobicL
26LLeucinehydrophobicL
27VValinehydrophobicL
28RArgininepositiveL
29GGlycinespecialLflexible
30RArgininepositiveL
31GGlycinespecialLflexible