Recovery & Repair · commonly explored around recovery and tissue repair

TB-500 (Thymosin β4)

Name: TB-500 (Thymosin β4) evidence record
Creator: OnimaChain

TB-500 is based on thymosin beta-4, a protein that helps cells move to where repair is needed. Animal studies link it to faster wound healing and tissue recovery, and it is a staple of recovery conversations.

Informational profile

No verified OnimaChain inventory for this profile.

Also known as Thymosin beta-4 · Tβ4 · TMSB4X · Thymosin β4 (synthetic fragment)

Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Length: 43 residues
MW: 4921.46 Da computed
Product tags: actin binding · thymosin · g actin sequestering
Checked sources: 5 sources in our record
Structure provenance: Sequence-derived illustration (not a measured structure)

Compare Save

See the simple guide ↓

Sequence-derived illustration (not a measured structure)

Video intro

TB-500 (Thymosin β4) in ten seconds.

Coming soon.

Meet TB-500 (Thymosin β4)

The short version, before the deep dive.

See the quick read See the studies

PulseChain

What’s new with TB-500 (Thymosin β4)

See the full TB-500 (Thymosin β4) pulse →

Section B

The quick read

Section C

Research at a glance

A simple picture of the sources we have checked. More color means more records in that category—not that the product works better.

Filled = we have checked studies of that kind · hollow = none yet · dashed = not checked yet. This is a picture of what exists, not a score.

#	Dimension	Verified	How
1	Cells in a dish (in vitro)	2	Checked studies done on cells in a lab dish.
2	Mice	1	Checked studies whose title says it was done in mice.
3	Rats	1	Checked studies whose title says it was done in rats.
4	Other animals	0 · none yet	Checked studies whose title names another animal.
5	People, observed	0 · none yet	Checked studies that watched people without a controlled trial.
6	Single-person reports	0 · none yet	Checked reports about one patient (case reports).
7	Phase I trial	0 · none yet	Checked early safety trials in a small group of people.
8	Phase II trial	0 · none yet	Checked mid-size trials testing whether it works.
9	Phase III trial	0 · none yet	Checked large trials, the kind regulators look at.
10	Approved use	Not checked yet	Not checked yet — we have not connected regulator records.
11	Repeated by others	Not checked yet	Not checked yet — we do not track repeat studies yet.
12	Separate research teams	Bayrak BY · Cha HJ · Lim DS · Lachowicz JI · Gesteira TF	How many different senior authors the checked studies have. A rough stand-in for separate teams.
13	How it works	1	Checked studies that looked at the mechanism, based on their summary.
14	Years of research	2020–2026	From the oldest to the newest checked study.

Section D

What the sources looked at

These topics come only from sources in our record. We do not add a topic just because it is popular online.

A source studied
Cell migration
Checked sources: PMID 34170491
A source studied
How cells move (actin)
Checked sources: PMID 34170491
A source studied
Wound-healing research
Checked sources: PMID 42542926, PMID 41235866
People discuss
Tissue-repair talk online
Live community feeds are not connected yet.

Section E

Why people look it up

A plain-language starting point. This is not a promise that the product will cause a result.

recovery and tissue repair

See TB-500 (Thymosin β4) beside similar names.

The Portal of Tides lets you switch between a constellation, connection view, checked-source timeline, and topic map. It uses the products already in our collection—no fake customer counts.

Open Portal of Tides

Section F

What the record can tell us

A product page can show what was studied. It cannot promise what will happen to a person.

What we can show

Cell migration1 checked
How cells move (actin)1 checked
Wound-healing research2 checked

What we cannot promise

A lab result, animal study, online story, or product page cannot tell you what will happen to you. That question needs qualified medical guidance.

The short versionresearch is not a guaranteeWe keep the product, source, and claim separate so you can see which is which.

Section G

Claims people make

The big claims tied to this product. Open one to see where it came from and how it spread.

CLAIM-TB4-CELL-MIGRATIONA claim we track

“TB-500 supports cell migration”

TB-500 (Thymosin β4) · about: cell-migration · Informational profile

Started withPMID 341704915 checked studies linked

Section H

How far it has been tested

From cells in a dish, to mice, rats, bigger animals, people, proper trials, and finally regulator approval. The light stops where the checked studies stop.

cell migration

Tested as far as: Cells in a dish — and no further

Cells in a disha checked study reached this stagereached
Mouseno checked study has reached this stagestops here
Ratno checked study has reached this stage
Bigger animalno checked study has reached this stage
Peopleno checked study has reached this stage
Proper human trialno checked study has reached this stage
Approved by regulatorsno checked study has reached this stage

Section I

How many separate teams

Ten papers from one lab are not ten separate confirmations.

Separate senior authors (a rough count of teams)

5 / 5 records

Bayrak BY1 record(s)
Cha HJ1 record(s)
Lim DS1 record(s)
Lachowicz JI1 record(s)
Gesteira TF1 record(s)

Universities, funding and who cites whom: not checked yet. PubMed’s summary does not include that, so it needs another data source.

Section J

What doesn’t fit?

If a study disagrees, it goes here. We do not hide it.

No study we have checked pushes back yet

Studies that found nothing, disagree, or criticize the method will show up here once we add them. A study that only partly agrees is not the same as one that disagrees.

Section K

Timeline

What happened and when. Studies in one lane, real-world reports in another.

Research

1 event

CLAIM-TB4-CELL-MIGRATION

2026-09-20researchchanged our reading

Claim record created

Before

— (no prior state)

After

tracked

Trials

0 events

No trial milestones are indexed to this exact record yet.

Regulatory

0 events

No regulator decisions listed yet.

Real-world reports

0 events

No real-world reports yet — social platforms are not connected.

Section L

Sources

Every study we used. Only studies we confirmed on PubMed are shown as sources. Where a drug is FDA-approved, its official label sits beside them — that is an approval, not a sales pitch.

No official FDA label for this product

We only attach an FDA record when the molecule is an approved drug and we have checked the application number. Most research peptides will stay empty here.

PMID 42542926Animal studyRat