Weight & Metabolism · commonly explored around metabolism and appetite

Tirzepatide

Tirzepatide works on two gut-hormone signals, GLP-1 and GIP, that control appetite and blood sugar. It is approved as Zepbound and Mounjaro, with about 21% average weight loss at the top dose in its main trial.

Informational profile

No verified OnimaChain inventory for this profile.

Also known as Mounjaro · Zepbound · LY3298176

Mapped targets

Sequence
YXEGTFTSDYSIXLDKIAQKAFVQWLIAGGPSSGAPPPS
Length
39 residues
MW
Product tags
glp 1r · gip r · incretin analogue
Checked sources
No checked source added yet
Structure provenance
Rendered from deposited C-alpha coordinates · RCSB PDB 7FIM chain P; any unresolved tail is modeled

Full sequence and key modifications are represented. Deposited receptor-bound structures resolve the helical core; the flexible tail is modeled.

See the simple guide ↓
SPPPAGSSPGGLIFAWVQQADAKKISSIGTLDXTYYEFX
Rendered from deposited C-alpha coordinates · RCSB PDB 7FIM chain P; any unresolved tail is modeled

Meet Tirzepatide

The short version, before the deep dive.

Tirzepatide works on two gut-hormone signals, GLP-1 and GIP, that control appetite and blood sugar. It is approved as Zepbound and Mounjaro, with about 21% average weight loss at the top dose in its main trial.

PulseChain

What’s new with Tirzepatide

Section B

The quick read

Section C

Research at a glance

A simple picture of the sources we have checked. More color means more records in that category—not that the product works better.

We haven’t added a checked source for this yet.

This picture fills in as we add checked studies for this product.

Section D

What the sources looked at

These topics come only from sources in our record. We do not add a topic just because it is popular online.

No topics yet

Topics show up here once we have checked studies for this product and sorted them.

Section E

Why people look it up

A plain-language starting point. This is not a promise that the product will cause a result.

metabolism and appetite

See Tirzepatide beside similar names.

The Portal of Tides lets you switch between a constellation, connection view, checked-source timeline, and topic map. It uses the products already in our collection—no fake customer counts.

Open Portal of Tides

Section F

What the record can tell us

A product page can show what was studied. It cannot promise what will happen to a person.

What we can show

No source topic has been added yet.

What we cannot promise

A lab result, animal study, online story, or product page cannot tell you what will happen to you. That question needs qualified medical guidance.

The short versionresearch is not a guaranteeWe keep the product, source, and claim separate so you can see which is which.

Section G

Claims people make

The big claims tied to this product. Open one to see where it came from and how it spread.

No claims tracked for this product yet

We only add a claim once we can point to where it started, or say clearly that we could not find out.

Section H

How far it has been tested

From cells in a dish, to mice, rats, bigger animals, people, proper trials, and finally regulator approval. The light stops where the checked studies stop.

We have not mapped how far any result has been tested yet.

Section I

How many separate teams

Ten papers from one lab are not ten separate confirmations.

Not checked yet

We only count teams from studies we have confirmed.

Section J

What doesn’t fit?

If a study disagrees, it goes here. We do not hide it.

No study we have checked pushes back yet

Studies that found nothing, disagree, or criticize the method will show up here once we add them. A study that only partly agrees is not the same as one that disagrees.

Section K

Timeline

What happened and when. Studies in one lane, real-world reports in another.

Research

0 events

No dated research update is indexed for this selection.

Trials

0 events

No trial milestones are indexed to this exact record yet.

Regulatory

0 events

No regulator decisions listed yet.

Real-world reports

0 events

No real-world reports yet — social platforms are not connected.

Section L

Sources

Every study we used. Only studies we confirmed on PubMed are shown as sources. Where a drug is FDA-approved, its official label sits beside them — that is an approval, not a sales pitch.

FDA application

Mounjaro (tirzepatide) — Drugs@FDA application overview

NDA 215866 · retrieved 2026-09-21

FDA-approved (2022) as Mounjaro. Current labeling: with diet and exercise to improve blood sugar in people 10 years and older with type 2 diabetes, and to reduce major cardiovascular events in adults with type 2 diabetes at high risk.

Boxed warning for thyroid C-cell tumors in rats; human relevance not determined.

Open source ↗

DailyMed index

Mounjaro (tirzepatide) — DailyMed label index

DailyMed query MOUNJARO · retrieved 2026-09-21

MOUNJARO (tirzepatide) injection, for subcutaneous use. Dual GIP and GLP-1 receptor agonist. Initial U.S. approval: 2022.

Open source ↗

FDA application

Zepbound (tirzepatide) — Drugs@FDA application overview

NDA 217806 · retrieved 2026-09-21

FDA-approved as Zepbound, a tirzepatide brand for chronic weight management in eligible patients. Not the same as a research-use vial.

Open source ↗

We have not added PubMed studies for this product yet. The official labels above are the sources for now.

The building blocks, one by one

#CodeResidueClassChiralityFeatures
1YTyrosinepolarL
2Aibα-Aminoisobutyric acidhydrophobicLAib
3EGlutamatenegativeL
4GGlycinespecialLflexible
5TThreoninepolarL
6FPhenylalaninehydrophobicL
7TThreoninepolarL
8SSerinepolarL
9DAspartatenegativeL
10YTyrosinepolarL
11SSerinepolarL
12IIsoleucinehydrophobicL
13Aibα-Aminoisobutyric acidhydrophobicLAib
14LLeucinehydrophobicL
15DAspartatenegativeL
16KLysinepositiveL
17IIsoleucinehydrophobicL
18AAlaninehydrophobicL
19QGlutaminepolarL
20KLysinepositiveLAcyl tether
21AAlaninehydrophobicL
22FPhenylalaninehydrophobicL
23VValinehydrophobicL
24QGlutaminepolarL
25WTryptophanhydrophobicL
26LLeucinehydrophobicL
27IIsoleucinehydrophobicL
28AAlaninehydrophobicL
29GGlycinespecialLflexible
30GGlycinespecialLflexible
31PProlinespecialLProline kink
32SSerinepolarL
33SSerinepolarL
34GGlycinespecialLflexible
35AAlaninehydrophobicL
36PProlinespecialLProline kink
37PProlinespecialLProline kink
38PProlinespecialLProline kink
39SSerinepolarLC-terminal amide